PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00099377001
Common NameGSBRNA2T00099377001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family TALE
Protein Properties Length: 474aa    MW: 53731.4 Da    PI: 6.7577
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00099377001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.85.1e-103253621954
                          HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          Fe   ++yp+++e+  LAk++gL+++qV +WF N R +
  GSBRNA2T00099377001 325 FEHflHPYPKESEKIMLAKQTGLSKNQVANWFINARVR 362
                          554458******************************88 PP

2BELL116.41.4e-37187258172
                 BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                          erqelq+kk+kLl+++++Vd+rY+qy++q+++++ssFe+vaglg+akpYts+Al++iSrhFrcL+da++eqi
  GSBRNA2T00099377001 187 ERQELQSKKNKLLTVVNQVDQRYNQYHHQMEALASSFEMVAGLGAAKPYTSVALNKISRHFRCLRDALKEQI 258
                          79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.3E-43130256IPR006563POX domain
PfamPF075262.4E-41136254IPR006563POX domain
PROSITE profilePS5007111.872303366IPR001356Homeobox domain
CDDcd000862.82E-10306367No hitNo description
SMARTSM003895.9E-8306370IPR001356Homeobox domain
SuperFamilySSF466891.67E-17307375IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-27309372IPR009057Homeodomain-like
PfamPF059205.7E-18323362IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 474 aa     Download sequence    Send to blast
MSVYYQTNVG MQSLYQKPIY LNEQQQQQQA SSSSAGGGLE VPNSGGSVQD EMLFIPPTTS  60
AGLNGSVTVS SNDLSFHGGG LSLSLGNQIQ YHYQNQLNYN PSLSNENGKS PSSGYINGVG  120
LYNNYRYETT GFVSSVLRSP YLKPTQLLLD EVVSVKKDSN KKIKNNDDKG QDFSENNTYN  180
EELSSSERQE LQSKKNKLLT VVNQVDQRYN QYHHQMEALA SSFEMVAGLG AAKPYTSVAL  240
NKISRHFRCL RDALKEQIQV IRGKLGEDKE SCEEHGERIP RLRYLDQRLR QQRALHQQLG  300
MVRPSWRPQR GLPENSVSIL CAWLFEHFLH PYPKESEKIM LAKQTGLSKN QVANWFINAR  360
VRLWKPMIEE MYKEEFGDSS SELLSNSNQD NNKKMQETSQ FKHEDSSSSQ QQSHENNNVP  420
YTSDADRATS GDYDSLMNYH QGFGVDDYNR YIGLGNQQDG RFSNPHQLHD FVV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A9e-15312370563Homeobox protein Meis2
4xrm_B9e-15312370563Homeobox protein Meis2
4xrs_A7e-15312369158Homeobox protein Meis1
4xrs_B7e-15312369158Homeobox protein Meis1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00099377001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3530930.0AF353093.1 Arabidopsis thaliana BEL1-like homeodomain 3 (BLH3) mRNA, complete cds.
GenBankAY0625450.0AY062545.1 Arabidopsis thaliana Similar to homeodomain proteins (At1g75410; F1B16.6) mRNA, complete cds.
GenBankAY0852780.0AY085278.1 Arabidopsis thaliana clone 142443 mRNA, complete sequence.
GenBankAY5984520.0AY598452.1 Arabidopsis thaliana BEL1-like homeodomain 3 protein mRNA, complete cds.
GenBankBT0001330.0BT000133.1 Arabidopsis thaliana Similar to homeodomain proteins (At1g75410) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009104706.10.0PREDICTED: BEL1-like homeodomain protein 3 isoform X1
SwissprotQ9FWS90.0BLH3_ARATH; BEL1-like homeodomain protein 3
TrEMBLA0A078BWF10.0A0A078BWF1_BRANA; BnaA07g21690D protein
TrEMBLM4CHS00.0M4CHS0_BRARP; Uncharacterized protein
STRINGBra003753.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38201959
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75410.20.0BEL1-like homeodomain 3
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]